추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
44 kDa
종 반응성
dog, horse, rat, rabbit, guinea pig, bovine, mouse, human, goat
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... LEF1(51176)
관련 카테고리
일반 설명
LEF1 is a transcription factor that interacts with β-catenin and modulates cell adhesion. This transcription factor also mediates nuclear responses via the Wnt signaling pathway.
Rabbit Anti-LEF1 (AB2) antibody recognizes chicken, human, mouse, rat, canine, rabbit, bovine, zebrafish, and pig LEF1.
Rabbit Anti-LEF1 (AB2) antibody recognizes chicken, human, mouse, rat, canine, rabbit, bovine, zebrafish, and pig LEF1.
면역원
Synthetic peptide directed towards the C terminal region of human LEF1
애플리케이션
Rabbit Anti-LEF1 (AB2) antibody can be used for western blot (2μg/ml) and IHC (4-8μg/ml, using paraffin-embedded tissues) applications.
생화학적/생리학적 작용
Lymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1.
서열
Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
J Behrens et al.
Nature, 382(6592), 638-642 (1996-08-15)
The cytoplasmic proteins beta-catenin of vertebrates and armadillo of Drosophila have two functions: they link the cadherin cell-adhesion molecules to the cytoskeleton, and they participate in the wnt/wingless signal pathway. Here we show, in a yeast two-hybrid screen, that the
Q Eastman et al.
Current opinion in cell biology, 11(2), 233-240 (1999-04-21)
LEF-1/TCF transcription factors mediate a nuclear response to Wnt signals by interacting with beta-catenin. Wnt signaling and other cellular events that increase the stability of beta-catenin result in transcriptional activation by LEF-1/TCF proteins in association with beta-catenin. In the absence
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.