WH0164832M1

Monoclonal Anti-LONRF2 antibody produced in mouse

clone 1C7, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-FLJ45273, Anti-LON peptidase N-terminal domain and ring finger 2, Anti-MGC126711, Anti-MGC126713, Anti-RNF192
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1C7, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2aκ
• GenBank accession no.: NM_198461
• UniProt accession no.: Q1L5Z9
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... LONRF2(164832)

Description

General description

The gene encoding LON peptidase N-terminal domain and ring finger 2 (LONRF2) is localized on human chromosome 2q11.2.

Immunogen

LONRF2 (NP_940863, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYCLALNPECNSVKKEAQKVMCEVLFSATANVHENLTSSIQSRLKAQGHSHMNAQALLEEGDA

Biochem/physiol Actions

LON peptidase N-terminal domain and ring finger 2 (LONRF2) has been linked to auto-immune diseases like rhematoid arthritis.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves