The Ca2+/Calmodulin Kinase II Inhibitor 281-309 controls the biological activity of Ca2+/Calmodulin Kinase II. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.
別名:
Ca2+/Calmodulin Kinase II Inhibitor 281-309, CaM Kinase II Inhibitor 281-309, MHRQETVDCLKKFNARRKLKGAILTTMLA-OH
A synthetic peptide containing the calmodulin binding site (290-309) and the autophosphorylation site (Thr286) of CaM kinase II. Can be phosphorylated at Thr286 by PKC. Useful as a calmodulin binding peptide. Inhibits CaM kinase II by blocking Ca2+/calmodulin activation (IC50 = 80 nM) and enzyme-active site (IC50 = 2 µM).
A synthetic peptide that contains the CaM-binding, inhibitory, and autophosphorylation domains of CaM kinase II. Can be phosphorylated at Thr286 by PKC. Useful as a calmodulin binding peptide. Inhibits CaM kinase II (IC50 = 80 nM) by blocking Ca2+/calmodulin activation and enzyme active site (IC50 = 2 µM).
Waxham, M.N., et al. 1993. Biochemistry32, 2923. Waxham, M.N., et al. 1993. Brain Res. 609, 1. Fukunaga, K., et al. 1990. J. Neurochem.54, 103. Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800. Colbran, R.J., et al. 1988. J. Biol. Chem.263, 18145.
法的情報
CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany