Skip to Content
Merck
All Photos(2)

Documents

Safety Information

SAB1412652

Sigma-Aldrich

ANTI-CA1 antibody produced in mouse

clone 10E4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

CA1, Car1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

10E4, monoclonal

form

buffered aqueous solution

mol wt

antigen 54.45 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CA1(759)

General description

Carbonic anhydrase 1 (CA1) is a cytosolic protein, encoded by the gene mapped to human chromosome 8q21.2. The encoded protein belongs to the carbonic anhydrase (CA) family. CA1 is highly expressed in blood. Its expression is also found in spinal cord motor neurons, intestinal, vascular, corneal epithelia, synovium and cardiac capillary endothelial cells.
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Variants of this gene have been described in some populations. Multiple alternatively spliced variants, encoding the same protein, have been identified. Transcript variants of CA1 utilizing alternative polyA_sites have been described in literature. (provided by RefSeq)

Immunogen

CA1 (AAH27890, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Biochem/physiol Actions

Carbonic anhydrase 1 (CA1) catalyzes the reversible hydration and dehydration reactions of CO2/ carbonic acid (H2CO3). It plays a vital role in transport of metal ions. In addition, it might also be involved in biomineralization and new bone formation. CA1 acts as an oncogene and leads to irregular cell calcification, apoptosis and migration in breast tumor tissues. Overexpression of the gene has been observed in serum of stage I non-small cell lung cancer (NSCLC) patients. It can be used as a potential biomarker for early diagnosis of NSCLC. Additionally, CA1 is also upregulated in amyotrophic lateral sclerosis (ALS) and is involved in motor neuron degeneration.

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

SAB1412652-100UG:


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yabing Zheng et al.
BMC cancer, 15, 679-679 (2015-10-16)
Although mammary microcalcification is frequently observed and has been associated with poor survival in patients with breast cancer, the genesis of calcification remains unclear. Carbonic anhydrase I (CA1) has been shown to promote calcification by catalysing the hydration of CO2.
KeQiu Li et al.
Ecotoxicology and environmental safety, 105, 51-58 (2014-05-03)
Electronic waste (e-waste) disposal is a growing problem in China, and its effects on human health are a concern. To determine the concentrations of pollutants in peripheral blood and genetic aberrations near an e-waste disposal area in Jinghai, China, blood
Dong-Bin Wang et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 37(1), 553-559 (2015-08-02)
This study aimed to identify candidate biomarkers associated with stage I non-small cell lung cancer (NSCLC). Sera from three groups, a lung cancer group (n = 11), benign control group (n = 12), and normal control group (n = 10), were collected and pooled. Protein expression
Xiaochen Liu et al.
International journal of molecular sciences, 17(11) (2016-11-04)
Carbonic anhydrase I (CA1) is the cytosolic isoform of mammalian α-CA family members which are responsible for maintaining pH homeostasis in the physiology and pathology of organisms. A subset of CA isoforms are known to be expressed and function in

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service