Skip to Content
Merck
All Photos(5)

Documents

Safety Information

HPA035526

Sigma-Aldrich

Anti-FYCO1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-FLJ13335, Anti-FYVE and coiled-coil domain containing 1, Anti-ZFYVE7

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

IQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKKYLEERLIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FYCO1(79443)

General description

FYVE and coiled-coil domain containing 1 (FYCO1) codes for a protein with 1478 amino acids. It has 18 exons and is of 79 kb in length. FYCO1 has a long central coiled-coil region flanked at the N terminus by an α-helical RUN domain or a zinc finger domain and at the C terminus by a FYVE domain. It is abundantly expressed in heart and skeletal muscle, skin, adipose tissue and the ovary. FYCO1 is a member of the emerging group of autophagic adaptor proteins. FYCO1 is located on human chromosome 3p21.31.

Immunogen

FYVE and coiled-coil domain containing 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-FYCO1 antibody has been used in immunostaining.

Biochem/physiol Actions

FYVE and coiled-coil domain containing 1 (FYCO1) helps in the movement of autophagosomes along microtubules through its association with LC3. Mutations in FYCO1 results in autosomal-recessive congenital cataracts. FYCO1 participates in the progression of lens and transparency in humans.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79454

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

HPA035526-100UL:
HPA035526-25UL:


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Repeated ER?endosome contacts promote endosome translocation and neurite outgrowth.
Raiborg C, et al.
Nature, 520(7546), 234-234 (2015)
Proteomics of rimmed vacuoles define new risk allele in inclusion body myositis.
Guttsches AK, et al.
Annals of Neurology, 81(2), 227-239 (2017)
Mutations in FYCO1 cause autosomal-recessive congenital cataracts.
Chen J, et al.
American Journal of Human Genetics, 88(6), 827-838 (2011)
Marlena Rohm et al.
Cells, 12(12) (2023-06-28)
Pompe disease is a rare genetic metabolic disorder caused by mutations in acid-alpha glucoside (GAA) leading to pathological lysosomal glycogen accumulation associated with skeletal muscle weakness, respiratory difficulties and cardiomyopathy, dependent from the GAA residual enzyme activity. This study aimed
Hallvard L Olsvik et al.
The Journal of biological chemistry, 290(49), 29361-29374 (2015-10-16)
FYCO1 (FYVE and coiled-coil protein 1) is a transport adaptor that binds to phosphatidylinositol 3-phosphate, to Rab7, and to LC3 (microtubule-associated protein 1 light chain 3) to mediate transport of late endosomes and autophagosomes along microtubules in the plus end

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service