Tutte le immagini(6)

Documenti

CdO/CdA

WH0051435M1

Monoclonal Anti-SCARA3 antibody produced in mouse

Name: Monoclonal Anti-SCARA3 antibody produced in mouse
Brand: SIGMA

clone 3A2, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-APC7, Anti-CSR, Anti-CSR1, Anti-MSLR1, Anti-MSRL1, Anti-scavenger receptor class A, member 3

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Tutte le immagini(6)

About This Item

Codice UNSPSC:

12352203

NACRES:

NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

3A2, monoclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

rat, human, mouse

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso Genebanck

NM_016240

N° accesso UniProt

Q6AZY7

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SCARA3(51435)

Categorie correlate

Primary Antibodies

Descrizione generale

This gene encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidative stress. Alternatively spliced transcript variants encoding distinct isoforms have been described. (provided by RefSeq)

Immunogeno

SCARA3 (NP_057324, 316 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE

Azioni biochim/fisiol

Scavenger receptor class A member 3 (SCARA3) protects cells against ultraviolet (UV) irradiation and oxidative stress. Reduced expression of SCARA3 increases oxidative stress in keratoconus (KC) cells in vitro. Quantitative polymerase chain reaction (PCR) analysis proves that SCARA3 transcript is highly expressed in ovarian/primary peritoneal carcinoma (OC/PPC) compared to breast carcinoma effusions. SCARA3 represses tumor growth and metastasis of prostate cancer. Therefore, it can be used as a potential therapeutic target for treating aggressive types of prostate cancer.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

nwg

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Downregulation of SCARA3, CPSF3 and FOXM1 in Keratoconus Cells in vitro

CM Kenney

Investigative Ophthalmology & Visual Science, 53, 1112-1112 (2012)

CSR1 suppresses tumor growth and metastasis of prostate cancer.

Guoying Yu et al.

The American journal of pathology, 168(2), 597-607 (2006-01-27)

Prostate cancer is frequent among men over 45 years of age, but it generally only becomes lethal with metastasis. In this study, we identified a gene called cellular stress response 1 (CSR1) that was frequently down-regulated and methylated in prostate

Scavenger receptor class A member 3 (SCARA3) in disease progression and therapy resistance in multiple myeloma.

Charles O Brown et al.

Leukemia research, 37(8), 963-969 (2013-03-30)

This study evaluates the role of scavenger receptor class A member 3 (SCARA3) in multiple myeloma (MM). SCARA3 expression was induced upon treatment with oxidative stressors (ionizing radiation and chemotherapeutic drugs). An epigenetic inactivation of SCARA3 was noted in MM.1S

SCARA3 mRNA is overexpressed in ovarian carcinoma compared with breast carcinoma effusions.

Annika J Bock et al.

Human pathology, 43(5), 669-674 (2011-08-23)

Scavenger receptor class A, member 3 (SCARA3) was previously found to be overexpressed in ovarian/primary peritoneal carcinoma (OC/PPC) compared with breast carcinoma effusions by global gene expression analysis. The present study aimed to validate this finding applying quantitative PCR and

CSR, a scavenger receptor-like protein with a protective role against cellular damage causedby UV irradiation and oxidative stress.

H J Han et al.

Human molecular genetics, 7(6), 1039-1046 (1998-06-13)

Oxidative stress is a pathogenic condition that causes cellular damage and, in a normally functioning cell, several transcription factors respond to this threat by modulating expression of genes whose products ameliorate the altered redox status in some way. We have

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.