WH0000094M1

Monoclonal Anti-ACVRL1 antibody produced in mouse

clone 5B1, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-ACVRLK1, Anti-ALK1, Anti-HHT, Anti-HHT2, Anti-ORW2, Anti-SKR3, Anti-activin A receptor type II-like 1
• Numero MDL: MFCD03791400
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 5B1, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso Genebanck: BC042637
• N° accesso UniProt: P37023
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ACVRL1(94)

Descrizione

Descrizione generale

This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. (provided by RefSeq)

Immunogeno

ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL

Caratteristiche e vantaggi

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)