SAB5702497

Anti-Peroxiredoxin 2 (PRDX2) Antibody, clone 1U9L9, Rabbit Monoclonal

• Sinonimo/i: HEL-S-2a, NKEF-B, NKEFB, PRP, PRX2, PRXII, PTX1, TDPX1, TPX1, TSA
• Codice UNSPSC: 12352203
• NACRES: NA.46

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 1U9L9, monoclonal
• Forma fisica: liquid
• PM: 22 kDa
• Reattività contro le specie: human, rat, rat
• Concentrazione: 0.50 mg/mL
• tecniche: western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLN
• N° accesso UniProt: P32119
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PRDX2(7001)

Descrizione

Descrizione generale

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13. [provided by RefSeq, Mar 2013]

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Peroxiredoxin 2 (PRDX2) (PRDX2) (P32119).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1