SAB1401130

Anti-FABP5 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: E-FABP, EFABP, PA-FABP, PAFABP
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: mouse, human
• tecniche: western blot: 1 μg/mL
• N° accesso NCBI: NM_001444
• N° accesso UniProt: Q01469
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... FABP5(2171)

Descrizione

Descrizione generale

This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. The human genome contains many pseudogenes similar to this locus. (provided by RefSeq)

Immunogeno

FABP5 (NP_001435.1, 1 a.a. ~ 135 a.a) full-length human protein.

Sequence
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Azioni biochim/fisiol

FABPs (fatty acid-binding proteins) bind saturated and unsaturated long-chain fatty acids reversibly and might be involved in the transport of lipids to specific cellular compartments. FABP5 (fatty acid binding protein 5) serves as a transporter for endocannabinoid. FABP5 is also known as epidermal FABP (E-FABP) or mal1. FABP5 is significantly associated with the development of insulin resistance and atherosclerosis. This gene was found to be overexpressed in cervical cancer and it serves as an important biomarker for cervical cancer. In vitro study proves that FABP5 is necessary for cell proliferation, colony formation, cell migration, and invasion of cervical cancer. FABP5 is associated with cancer types such as bladder, pancreas, prostate, breast cancer and glioblastoma.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable