SAB1400307

Anti-HSD17B8 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

• Sinonimo/i: Anti-D6S2245E, Anti-FABG, Anti-FABGL, Anti-H2-KE6, Anti-HKE6, Anti-KE6, Anti-RING2, Anti-dJ1033B10.9
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: western blot: 1 μg/mL
• N° accesso UniProt: Q92506
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... HSD17B8(7923)

Descrizione

Descrizione generale

In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. (provided by RefSeq)

Immunogeno

HSD17B8 (NP_055049.1, 1 a.a. ~ 261 a.a) full-length human protein.

Sequence
MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable