HPA023918

Anti-STC1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-STC-1, Anti-Stanniocalcin-1
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA023918
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• tecniche: immunohistochemistry: 1:50-1:200
• Sequenza immunogenica: EQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESL
• N° accesso UniProt: P52823
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... STC1(6781)

Descrizione

Descrizione generale

STC1 (stanniocalcin 1) is a hypocalcemic hormone, which is produced and released by corpuscles of Stannius (CS), an endocrine gland found in bony fish. It is a glycoprotein and in humans, it is widely expressed such as in heart, lung, adrenal gland, liver, kidney, spleen, ovary, prostate, bone and colon.

Immunogeno

Stanniocalcin-1 Precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Azioni biochim/fisiol

STC1 (stanniocalcin 1) is responsible for calcium homeostasis in mammals. However, unlike its counterpart in fishes, it functions in a paracrine/autocrine manner in mammals. Studies in mice show that this hormone is primarily involved in carcinogenesis and inflammatory processes in mammals. This gene is significantly up-regulated in human lung, breast, ovary, liver, pancreas, and colon cancer samples. It decreases the size of tumor in HCC (hepatocellular carcinoma) due to its pro-apoptotic and anti-inflammatory actions. Thus, it might have potential therapeutic functions in patients with inflammatory tumors in HCC. Silencing of this gene in ccRCC (clear cell renal cell carcinoma) resulted in prevention of cell proliferation, invasion and metastasis, whereas suppression of this gene resulted in inhibition of EMT (epithelial-mesenchymal transition).

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST76321

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1