HPA012128
Anti-TNIK antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinonimo/i:
Anti-TRAF2 and NCK-interacting protein kinase
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Origine biologica
rabbit
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Nome Commerciale
Prestige Antibodies® Powered by Atlas Antibodies
Forma fisica
buffered aqueous glycerol solution
Reattività contro le specie
human
tecniche
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
Sequenza immunogenica
QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSS
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... TNIK(23043)
Immunogeno
TRAF2 and NCK-interacting protein kinase recombinant protein epitope signature tag (PrEST)
Applicazioni
Anti-TNIK antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Immunohistochemistry (1 paper)
Azioni biochim/fisiol
TNIK (TRAF2 and NCK interacting kinase) is a protein kinase belonging to the germinal center kinase family. It consists of an N-terminal kinase domain. It is localized in the nucleus. TNIK is highly involved in the cytoskeleton assembly and neuronal dendrite extension. In cytoskeleton arrangement, it directly interacts with Rap2 for the proper distribution and spreading of cells. It also stimulates c-Jun N-terminal kinase for the cytoskeleton regulation. TNIK acts as transcription activator during Wnt signaling, which is an essetial step for several physiological processes, including cell proliferation, differentiation, motility, apoptosis. It also plays an important role in the intestinal crypts and colorectal cancer cells. It has been suggested that TNIK can be a potential pharmacological kinase inhibitor for the treatment of colorectal cancer.
Caratteristiche e vantaggi
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST71436
Stato fisico
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Note legali
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 1
Dispositivi di protezione individuale
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Hidenori Takahashi et al.
BMC cancer, 15, 794-794 (2015-10-27)
The potential of expression profiling using microarray analysis as a tool to predict the prognosis for different types of cancer has been realized. This study aimed to identify a novel biomarker for colorectal cancer (CRC). The expression profiles of cancer
C A Fu et al.
The Journal of biological chemistry, 274(43), 30729-30737 (1999-10-16)
Germinal center kinases (GCKs) compose a subgroup of the Ste20 family of kinases. Here we describe the cloning and characterization of a novel GCK family kinase, Traf2- and Nck-interacting kinase (TNIK) that interacts with both Traf2 and Nck. TNIK encodes
D-H Yu et al.
Oncogenesis, 2, e89-e89 (2014-02-26)
Traf2- and Nck-interacting kinase (TNIK) is one of the germinal center kinase family members involved in cytoskeleton organization and neuronal dendrite extension. Emerging evidence supports that TNIK is essential for activation of WNT signaling pathway in colon cancer growth. To
Alain C Burette et al.
The Journal of comparative neurology, 523(13), 1913-1924 (2015-03-11)
Tumor necrosis factor receptor-associated factor 2 (TRAF2)- and noncatalytic region of tyrosine kinase (NCK)-interacting kinase (TNIK) has been identified as an interactor in the psychiatric risk factor, Disrupted in Schizophrenia 1 (DISC1). As a step toward deciphering its function in
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.