AV42055

Anti-SerPINB5 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Maspin, Anti-PI5, Anti-Serpin peptidase inhibitor, clade B (ovalbumin), member 5
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 41 kDa
• Reattività contro le specie: human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_002630
• N° accesso UniProt: P36952
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SERPINB5(5268)

Descrizione

Descrizione generale

Maspin/Serpin peptidase inhibitor, clade B (ovalbumin), member 5 (SerPINB5), serpin family, is a serine protease inhibitor originally identified as a tumor suppressor in epithelial cells. Maspin reduces the motility/invasiveness of tumor cells and functions as an angiogenesis inhibitor.

Specificità

Anti-SerPINB5 polyclonal antibody reacts with canine, chicken, rat, bovine, human, mouse, and rabbit Maspin/Serpin peptidase inhibitor, clade B (ovalbumin), member 5 proteins.

Immunogeno

Synthetic peptide directed towards the middle region of human SERPINB5

Applicazioni

Anti-SerPINB5 polyclonal antibody is used to tag maspin for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of maspin in processes such as angiogenesis and tumor suppression.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Azioni biochim/fisiol

As a tumor suppressor, it blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.

Sequenza

Synthetic peptide located within the following region: NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable