AV32738

Anti-MyEF2 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-Myelin expression factor 2
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 64 kDa
• Reattività contro le specie: dog, rat, human, rabbit, mouse, bovine, horse, guinea pig
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_057216
• N° accesso UniProt: Q9P2K5
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MYEF2(50804)

Descrizione

Descrizione generale

Myelin basic protein (MBP) is a major component of the myelin sheath whose production is developmentally controlled during myelinogenesis. Myelin expression factor 2 (MyEF2), a single-stranded DNA binding factor, is a repressor of myelin basic protein (MBP) expression. MyEF2 interacts with RUNX1 to represses hematopoietic genes in erythroid cells.

Rabbit polyclonal anti-MyEF2 antibody reacts with bovine, canine, human, mouse, rat, zebrafish, and chicken myelin expression factor 2 proteins.

Immunogeno

Synthetic peptide directed towards the middle region of human MYEF2

Applicazioni

Rabbit Anti-MyEF2 can be used for western blot (1 μg/ml) and IHC (4-8 μg/ml) applications.

Rabbit polyclonal anti-MyEF2 antibody is used to tag myelin expression factor 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of myelin expression factor 2 in the repression of genes involved in myelinogenesis and hematopoiesis.

Azioni biochim/fisiol

MEF-2 is expressed early in the differentiation program and is suppressed by specific polypeptide growth factors. The ability of MEF-2 to recognize conserved activating elements associated with multiple-specific genes suggests that this factor may participate in the coordinate regulation of genes during myogenesis.

Sequenza

Synthetic peptide located within the following region: QAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMG

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable