Skip to Content
Merck
All Photos(6)

Key Documents

HPA001812

Sigma-Aldrich

Anti-APOBEC3G antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-APOBEC-related cytidine deaminase antibody produced in rabbit, Anti-APOBEC-related protein antibody produced in rabbit, Anti-ARCD antibody produced in rabbit, Anti-ARP-9 antibody produced in rabbit, Anti-CEM-15 antibody produced in rabbit, Anti-CEM15 antibody produced in rabbit, Anti-DNA dC→dU-editing enzyme APOBEC-3G antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

APOBEC3G (apolipoprotein B messenger-RNA-editing enzyme, catalytic polypeptide-like 3G) belongs to the APOBEC family of cytidine deaminases. It is expressed predominantly in cytoplasmic region. It is localized in pyramidal neurons within the gray matter of cerebral and cerebellar cortices. It has a core α-β-α fold structure for catalytic activity. The five-stranded β-sheet is surrounded on both sides by six α-helices arranged over a hydrophobic platform.

Immunogen

DNA dC→dU-editing enzyme APOBEC-3G recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

APOBEC3G (apolipoprotein B mRNA editing enzyme catalytic subunit 3G) is associated with diverse biological functions such as mRNA editing, inhibiting the mobilization of retroviruses and retrotransposons, including the inhibition of human immunodeficiency virus-1 (HIV-1) replication. It can restrict HIV-1 infectivity during reverse transcription, by inserting in viral particles and deaminating the viral cDNA cytidines to uridines. The deaminated uridines mutate the DNA strand to generate stop codons for the inactivation of the virus. However, with the help of viral Vif protein HIV-1 can counteracts APOBEC3G by protosomal degradation.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73531

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Brandon Leonard et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 22(18), 4746-4755 (2016-03-27)
APOBEC3 DNA cytosine deaminase family members normally defend against viruses and transposons. However, deregulated APOBEC3 activity causes mutations in cancer. Because of broad expression profiles and varying mixtures of normal and cancer cells in tumors, including immune cell infiltration, it
M Sarah Hill et al.
AIDS research and human retroviruses, 22(6), 541-550 (2006-06-27)
The Vif protein of human immunodeficiency virus-1 (HIV-1) has been shown to interact with members of the APOBEC family of cytidine deaminases, particularly APOBEC3G/F. In this study, we isolated RNA from 12 regions of the brain from two pigtailed macaques
Takashi Iizuka et al.
American journal of reproductive immunology (New York, N.Y. : 1989), 78(4) (2017-06-08)
APOBEC3G (A3G) is a cytidine deaminase that exhibits antiviral activity by introducing C-to-T hypermutation in viral DNA. We recently observed the distinct presence of C-to-T hypermutation of human papillomavirus DNA in uterine cervical intraepithelial neoplasia (CIN), suggesting the possible involvement
Kuan-Ming Chen et al.
Nature, 452(7183), 116-119 (2008-02-22)
The human APOBEC3G (apolipoprotein B messenger-RNA-editing enzyme, catalytic polypeptide-like 3G) protein is a single-strand DNA deaminase that inhibits the replication of human immunodeficiency virus-1 (HIV-1), other retroviruses and retrotransposons. APOBEC3G anti-viral activity is circumvented by most retroelements, such as through
Shivender M D Shandilya et al.
Structure (London, England : 1993), 18(1), 28-38 (2010-02-16)
APOBEC3G is a DNA cytidine deaminase that has antiviral activity against HIV-1 and other pathogenic viruses. In this study the crystal structure of the catalytically active C-terminal domain was determined to 2.25 A. This structure corroborates features previously observed in

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service