Skip to Content
Merck
All Photos(4)

Key Documents

HPA007097

Sigma-Aldrich

Anti-PTPN12 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-PTPG1 antibody produced in rabbit, Anti-Protein-tyrosine phosphatase G1 antibody produced in rabbit, Anti-Tyrosine-protein phosphatase non-receptor type 12 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
₪2,929.00

₪2,929.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
₪2,929.00

About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

₪2,929.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

SVTQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGHVTWSFHGPENAIPIPDLSEGNSSDINYQTRKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNPLHSDDSDSDERNSDGAVTQNKTNISTASATVSAAT

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PTPN12(5782)

Immunogen

Tyrosine-protein phosphatase non-receptor type 12 recombinant protein epitope signature tag (PrEST)

Application

Anti-PTPN12 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues.[1][2] These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

PTPN12 (Protein tyrosine phosphatase, non-receptor type 12) is a protein tyrosine phosphatase regulating reactive oxygen species (ROS) level. It also regulates FOXO1/3a signaling for the upregulation of several antioxidant genes. It is a tumor suppressor gene. It acts as a novel prognostic biomarker for identifying the level of cancer growth, proliferation, and metastasis, for the esophageal squamous cell carcinoma (ESCC), triple-negative breast cancer (TNBC).[1][2]

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71387

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

I S Harris et al.
Oncogene, 33(8), 1047-1054 (2013-02-26)
It is well known that protein tyrosine phosphatases (PTPs) that become oxidized due to exposure to reactive oxygen species (ROS) undergo a conformational change and are inactivated. However, whether PTPs can actively regulate ROS levels in order to prevent PTP
Xun Cao et al.
Oncotarget, 6(13), 11704-11713 (2015-04-15)
Tyrosine-protein phosphatase non-receptor type 12 (PTPN12) has been considered to be a tumor suppressor in human cancer, but its clinical and prognostic significance in non-small cell lung cancer (NSCLC) has not been well elucidated.A retrospective analysis of 215 patients with
Min-Qing Wu et al.
Asian Pacific journal of cancer prevention : APJCP, 14(1), 287-292 (2013-03-29)
Low tyrosine-protein phosphatase nonreceptor type 12 (PTPN12) expression may be associated with breast cancer growth, proliferation, and metastasis. However, the prognostic value of PTPN12 in breast cancer has not been clearly identified. 51 triple-negative breast cancer (TNBC) patients and 83
Xun Cao et al.
The Annals of thoracic surgery, 93(5), 1674-1680 (2012-03-21)
Tyrosine-protein phosphatase nonreceptor type 12 (PTPN12) is considered to be a tumor suppressor. It plays a significant role in human cancer, but its clinicopathologic and prognostic significance in esophageal squamous cell carcinoma (ESCC) has not yet been elucidated. Using Western

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service