AV34806

Anti-ZNF627 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-Zinc finger protein 627
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 53 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_660338
• UniProt accession no.: Q7L945
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... ZNF627(199692)

Description

General description

ZNF627 codes for a zinc finger protein. ZNF627 polymorphisms are reportedly associated with the risk of myocardial infarction. Rabbit Anti-ZNF627 antibody recognizes human ZNF627.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZNF627

Application

Rabbit Anti-ZNF627 antibody is suitable for western blot applications at a concentration of 0.125 μg/ml.

Biochem/physiol Actions

Located on chromosome 19, this gene encodes for zinc finger protein 627.

Sequence

Synthetic peptide located within the following region: GKQWEDQNIEDPFKIPRRNISHIPERLCESKEGGQGEETFSQIPDGILNK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable