AV44817

Anti-RHOT1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ARHT1, Anti-FLJ11040, Anti-FLJ12633, Anti-MIRO-1, Anti-Ras homolog gene family, member T1
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• antibody form: affinity isolated antibody
• Quality Level: 100
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 71 kDa
• species reactivity: rabbit, horse, bovine, rat, human, mouse, guinea pig, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_060777
• UniProt accession no.: Q8IXI2
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RHOT1(55288)

Descripción

General description

Anti-RHOT1 polyclonal antibody reacts with RHOT1 in chicken, bovine, human, zebrafish, pig, rat, canine, and mouse.

Ras homolog gene family, member T1 (RHOT1, MIRO-1) is an atypical Rho GTPase involved in calcium sensitive mitochondrial trafficking. Miro interacts with the kinesin-binding proteins GRIF-1 and OIP106 forming a link between the mitochondria and the trafficking apparatus of the microtubules. Miro1 and the kinesin adaptor Grif-1 play an important role in regulating mitochondrial transport in neurons. Miro1 is a calcium sensor for glutamate receptor-dependent localization of mitochondria at synapses.

Immunogen

Synthetic peptide directed towards the N terminal region of human RHOT1

Application

Anti-RHOT1 polyclonal antibody is suitable for use in western blotting and immunohistochemical (IHC) techniques. The antibody is used as a probe to determine the role of RHOT1 in calcium-sensitive mitochondrial trafficking.

Biochem/physiol Actions

Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.

Sequence

Synthetic peptide located within the following region: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable