Accéder au contenu
Merck
Toutes les photos(6)

Key Documents

HPA012323

Sigma-Aldrich

Anti-CSF1R antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

CSF1R Antibody - Anti-CSF1R antibody produced in rabbit, Csf1R Antibody, Anti-CD115 antigen, Anti-CSF-1-R, Anti-Fms proto-oncogene, Anti-Macrophage colony-stimulating factor 1 receptor precursor, Anti-c-fms

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(6)

About This Item

Numéro MDL:
MFCD00282160
Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
HPA012323
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

recombinant expression
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Séquence immunogène

NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP

Numéro d'accès UniProt

P07333

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CSF1R(1436)

Description générale

CSF1R (Colony stimulating factor 1 receptor), a type III receptor tyrosine kinase, is a member of the platelet-derived growth factor (PDGF) receptor family. Structurally, it is composed of five immunoglobulin-like domains, a transmembrane domain, a juxtamembrane domain (JM) and a protein kinase domain separated into two parts by an insert domain (KID).
CSF1R is located on human chromosome 5q32.

Immunogène

Macrophage colony-stimulating factor 1 receptor precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-CSF1R antibody has been used:
  • in cell lysis
  • in immunoprecipitation
  • in western blotting
  • in immunohistochemical analysis

Actions biochimiques/physiologiques

CSF1R (Colony stimulating factor 1 receptor) is a major molecule in the innate immunity, cancer, and inflammatory diseases, including systemic lupus erythematosus, arthritis, atherosclerosis and obesity. It regulates developmental activities including cell survival, proliferation, differentiation, and function of mononuclear phagocytes. It has been reported that CSF-1 autocrine loop helps to activate macrophages. In actual state, it exists as an autoinhibited form, and upon activation, it dimerizes. Later, it autophosphorylates tyrosine residues in the intracellular domain, followed by the recruitment of signaling molecules as well as internalization of the receptor. Mutation in the CSF1R causes several diseases including myeloid malignancies.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST86535

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Multi-level whole genome analysis reveals candidate biomarkers in clear cell renal cell carcinoma
Girgis A H, et al.
Cancer research, canres-ca0656 (2012)
Violeta Chitu et al.
Current opinion in immunology, 18(1), 39-48 (2005-12-13)
Colony-stimulating factor-1 (CSF-1, also known as macrophage-CSF) is the primary regulator of the survival, proliferation, differentiation and function of mononuclear phagocytes. Studies that involve CSF-1-deficient mice demonstrate that there is a variable requirement for CSF-1 in the development of individual
Xingchao Wang et al.
Frontiers in oncology, 12, 850767-850767 (2022-04-22)
Colony stimulating factor 1 receptor (CSF-1R) is a single channel III transmembrane receptor tyrosine kinase (RTK) and plays an important role in immune regulation and the development of various cancer types. The expression of CSF-1R in colon adenocarcinoma (COAD) and
Harvey I Pass et al.
Oncotarget, 7(35), 56408-56421 (2016-08-04)
In the present work we show that multiple lung cancer cell lines contain cisplatin resistant cell subpopulations expressing the Colony-Stimulating-Factor-Receptor-1 (CSF-1R) and surviving chemotherapy-induced stress. By exploiting siRNA-mediated knock down in vitro and the use of an investigational CSF-1R TKI
High co-expression of IL-34 and M-CSF correlates with tumor progression and poor survival in lung cancers
Baghdadi M, et al.
Scientific reports, 8(1), 418-418 (2018)
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique