SAB1403498

Monoclonal Anti-ANKRD37 antibody produced in mouse

clone 6E8, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Lrp2bp, MGC111507
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 6E8, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~43.9 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_181726
• UniProt accession no.: Q7Z713
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ANKRD37(353322)

Description

General description

Ankyrin repeat domain 37 (ANKRD37) is a protein containing ankyrin repeats (ARs) and a nuclear localization signal (NLS). The protein is expressed in human testis, small intestine, colon, blood leukocytes and human pancreatic adenocarcinoma cells. The gene is located on human chromosome 4q35.1.

Immunogen

ANKRD37 (NP_859077.1, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC

Biochem/physiol Actions

Ankyrin repeat domain 37 (ANKRD37) is important in protein-protein interactions and signalling pathways. It acts as a target gene for hypoxia-inducible factor 1 (HIF-1).

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable