WH0051232M1

Monoclonal Anti-CRIM1 antibody produced in mouse

clone 6E4, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-S52, Anti-cysteine-rich motor neuron 1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 6E4, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès GenBank: NM_016441
• Numéro d'accès UniProt: Q9NZV1
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CRIM1(51232)

Description

Description générale

The gene encoding cysteine-rich motor neuron 1 (CRIM1) is localized on human chromosome 2p21. It is a putative transmembrane protein which possesses an insulin-like growth factor (IGF)-binding protein motif and multiple cysteine-rich repeats. CRIM1 is an antagonist of bone morphogenetic proteins. The CRIM1 gene encodes a type I transmembrane protein that is mainly expressed in angiogenic endothelial cells.

Immunogène

CRIM1 (NP_057525, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI

Application

Monoclonal Anti-CRIM1 antibody produced in mouse has been used in Western blotting.

Actions biochimiques/physiologiques

Cysteine-rich motor neuron 1 (CRIM1) may interact with growth factors implicated in motor neuron differentiation and survival. It may have a role in the development of the central nervous system (CNS). CRIM1 influences the adhesion and migration of cancer cells. It modulates the maturation of bone morphogenetic preprotein.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): nwg
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)