WH0011218M1
Monoclonal Anti-DDX20 antibody produced in mouse
clone 5H5, purified immunoglobulin, buffered aqueous solution
Synonyme(s) :
Anti-DEAD (Asp-Glu-Ala-Asp) box polypeptide 20, Anti-DKFZp434H052, Anti-DP103, Anti-GEMIN3
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Source biologique
mouse
Conjugué
unconjugated
Forme d'anticorps
purified immunoglobulin
Type de produit anticorps
primary antibodies
Clone
5H5, monoclonal
Forme
buffered aqueous solution
Espèces réactives
human
Technique(s)
immunofluorescence: suitable
indirect ELISA: suitable
Isotype
IgG2aκ
Numéro d'accès GenBank
Numéro d'accès UniProt
Conditions d'expédition
dry ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... DDX20(11218)
Catégories apparentées
Description générale
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which has an ATPase activity and is a component of the survival of motor neurons (SMN) complex. This protein interacts directly with SMN, the spinal muscular atrophy gene product, and may play a catalytic role in the function of the SMN complex on RNPs. (provided by RefSeq)
Immunogène
DDX20 (NP_009135, 725 a.a. ~ 824 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ
Sequence
EGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ
Actions biochimiques/physiologiques
The gene DDX20 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 20) encodes a RNA helicase that forms a part of the SMN (survival-of-motor-neurons) complex, which is involved in the processing and assembly of RNPs (ribonucleoproteins), such as, snRNPs (spliceosomes), snoRNPs, miRNPs, hnRNPs and transcriptosomes. It plays an essential role in early embryonic development, where it is involved in silencing of maternal transcripts and processing of RNA. DDX20 plays a part in hind brain development where it suppresses the transcription of Egr2 (early growth response 2) gene. It regulates macrophage differentiation and proliferation by silencing the expression of Ets target genes involved in Ras pathway. It also acts as a cofactor in the SUMOylation of SF-1 (steroidogenic factor 1) by PIASy (protein inhibitor of activated STAT Y). This protein facilitates the assembly of the core of SMN complex, and this activity of DDX20 is associated with spinal muscular atrophy (SMA). DDX20 acts as an oncogene that facilitates metastasis, in human breast cancer, and has potential as a therapeutic target for the same.
Caractéristiques et avantages
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Forme physique
Solution in phosphate buffered saline, pH 7.4
Informations légales
GenBank is a registered trademark of United States Department of Health and Human Services
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Équipement de protection individuelle
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Xiankui Sun et al.
Cell stress & chaperones, 15(5), 567-582 (2010-02-17)
A number of missense mutations in the two related small heat shock proteins HspB8 (Hsp22) and HspB1 (Hsp27) have been associated with the inherited motor neuron diseases (MND) distal hereditary motor neuropathy and Charcot-Marie-Tooth disease. HspB8 and HspB1 interact with
Eun Myoung Shin et al.
The Journal of clinical investigation, 124(9), 3807-3824 (2014-08-02)
Despite advancement in breast cancer treatment, 30% of patients with early breast cancers experience relapse with distant metastasis. It is a challenge to identify patients at risk for relapse; therefore, the identification of markers and therapeutic targets for metastatic breast
Karl B Shpargel et al.
Proceedings of the National Academy of Sciences of the United States of America, 102(48), 17372-17377 (2005-11-23)
Spinal muscular atrophy (SMA) is a neurodegenerative disease characterized by loss of spinal motor neurons. The gene encoding the survival of motor neurons (SMN) protein is mutated in >95% of SMA cases. SMN is the central component of a large
Jean-François Mouillet et al.
Endocrinology, 149(5), 2168-2175 (2008-02-09)
The DEAD-box helicase DP103 (Ddx20, Gemin3) is a multifunctional protein that interacts with Epstein-Barr virus nuclear proteins (EBNA2/EBNA3) and is a part of the spliceosomal small nuclear ribonucleoproteins complex. DP103 also aggregates with the micro-RNA machinery complex. We have previously
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique