Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

WH0004857M7

Sigma-Aldrich

Monoclonal Anti-NOVA1 antibody produced in mouse

clone 3F3, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-Nova1, Anti-neuro-oncological ventral antigen 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3F3, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human, rat, mouse

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Informations sur le gène

human ... NOVA1(4857)

Description générale

Neuro-oncological ventral antigen 1 (NOVA1) is expressed in fibroblasts. It is part of the Nova family of neuron-specific RNA-binding proteins. The NOVA1 gene is localized on human chromosome 14q12.[1][2][3]

Immunogène

NOVA1 (NP_002506, 408 a.a. ~ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG

Actions biochimiques/physiologiques

NOVA1(Neuro-oncological ventral antigen 1) is associated with several post-transcriptional regulation of RNA metabolism including RNA splicing, editing to transport, localization, and degradation.[4] It may be involved in mediating neuronal responsiveness.[4] It encodes a protein which has homology with the RNA-binding protein hnRNP K, the yeast splicing protein MER1. Since, it has some homology with hnRNP K, it may influence the regulation of RNA splicing or metabolism in developing neurons.[5] The importance of NOVA1 as prognostic marker has been reported in HCC (Hepatocellular carcinoma).[6] Alteration in gene causes a disorder associated with breast cancer and motor dysfunction i.e. paraneoplastic opsoclonus myoclonus ataxia (POMA).[7]

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Implications of NOVA1 suppression within the microenvironment of gastric cancer: association with immune cell dysregulation.
Kim EK
Gastric cancer : official journal of the International Gastric Cancer Association and the Japanese Gastric Cancer Association (2017)
14q12 and severe Rett-like phenotypes: new clinical insights and physical mapping of FOXG1-regulatory elements
Lila Allou
European Journal of Human Genetics (2012)
MiR-181b-5p downregulates NOVA1 to suppress proliferation, migration and invasion and promote apoptosis in astrocytoma.
Zhi F
PLoS ONE (2014)
Mylène Hervé et al.
Disease models & mechanisms, 9(8), 899-909 (2016-08-03)
Familial dysautonomia (FD) is a rare neurodegenerative disease caused by a mutation in intron 20 of the IKBKAP gene (c.2204+6T>C), leading to tissue-specific skipping of exon 20 and a decrease in the synthesis of the encoded protein IKAP (also known
Yi-An Zhang et al.
PloS one, 9(3), e90955-e90955 (2014-03-13)
Neuro-oncological ventral antigen 1 (Nova1) is a neuron-specific RNA-binding protein in human paraneoplastic opsoclonus-myoclonus ataxia accompanying with malignant tumors, but its role in hepatocellular carcinoma (HCC) remains elusive. In this study, we found that overexpressed intratumoral Nova1 was associated with

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique