SAB1401130

Anti-FABP5 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : E-FABP, EFABP, PA-FABP, PAFABP
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Espèces réactives: mouse, human
• Technique(s): western blot: 1 μg/mL
• Numéro d'accès NCBI: NM_001444
• Numéro d'accès UniProt: Q01469
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... FABP5(2171)

Description

Description générale

This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. The human genome contains many pseudogenes similar to this locus. (provided by RefSeq)

Immunogène

FABP5 (NP_001435.1, 1 a.a. ~ 135 a.a) full-length human protein.

Sequence
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Actions biochimiques/physiologiques

FABPs (fatty acid-binding proteins) bind saturated and unsaturated long-chain fatty acids reversibly and might be involved in the transport of lipids to specific cellular compartments. FABP5 (fatty acid binding protein 5) serves as a transporter for endocannabinoid. FABP5 is also known as epidermal FABP (E-FABP) or mal1. FABP5 is significantly associated with the development of insulin resistance and atherosclerosis. This gene was found to be overexpressed in cervical cancer and it serves as an important biomarker for cervical cancer. In vitro study proves that FABP5 is necessary for cell proliferation, colony formation, cell migration, and invasion of cervical cancer. FABP5 is associated with cancer types such as bladder, pancreas, prostate, breast cancer and glioblastoma.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable