HPA037837
Anti-IPMK antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-Inositol polyphosphate multikinase
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous glycerol solution
Espèces réactives
human
Validation améliorée
recombinant expression
Learn more about Antibody Enhanced Validation
Technique(s)
immunofluorescence: 0.25-2 μg/mL
Séquence immunogène
DCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSD
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... IPMK(253430)
Description générale
The gene encoding inositol polyphosphate multikinase (IPMK) enzyme is located on human chromosome 10q21.1. IPMK consists of inositol phosphate binding, nuclear localization signal, and ATP-binding kinase domain. It is a catalytically flexible enzyme and is part of intracellular signalling network.
Immunogène
inositol polyphosphate multikinase recombinant protein epitope signature tag (PrEST)
Application
Anti-IPMK antibody produced in rabbit may be used for the detection of IPMK protein in
- lymphoblasts by immunoprecipitation
- human adenocarcinogenic cell lines by western blotting
- in mouse 3T3 cells by western blotting
Actions biochimiques/physiologiques
Inositol polyphosphate multikinase (IPMK) indirectly mediates mRNA transport from nucleus to cytoplasm by mediating synthesis of phosphatidylinositol levels. IPMK interacts and stabilizes tumor necrosis factor receptor in HEK293T cells.IPMK coordinates with various signaling networks. Its deletion impairs immune response signalling pathways. Knockdown of IPMK leads to imbalance in the inositol polyphosphates. IPMK binds to tumor suppressor protein and regulates transcription and cell death. Mutation in the IPMK gene results in a truncated protein with reduced kinase activity. IPMK gene deletion or RNA interference results in cell growth inhibition. IPMK is regarded as prime target for tumor suppression. Pathology of Huntington′s disease is associated with IPMK protein depletion. In Alzheimer′s patients, low IPMK transcript levels may play a key in neurodegeneration.
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST80294
Forme physique
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
The human homolog of the rat inositol phosphate multikinase is an inositol 1, 3, 4, 6-tetrakisphosphate 5-kinase
Chang , et al.
The Journal of Biological Chemistry, 277(46), 43836-43843 (2002)
Oisun Jung et al.
The EMBO journal, 43(9), 1740-1769 (2024-04-03)
The Hippo pathway effectors Yes-associated protein 1 (YAP) and its homolog TAZ are transcriptional coactivators that control gene expression by binding to TEA domain (TEAD) family transcription factors. The YAP/TAZ-TEAD complex is a key regulator of cancer-specific transcriptional programs, which
Inositol polyphosphate multikinase promotes Toll-like receptor-induced inflammation by stabilizing TRAF6
Kim E, et al.
Science Advances, 3(4), e1602296-e1602296 (2017)
The human homologue of yeast ArgRIII protein is an inositol phosphate multikinase with predominantly nuclear localization
Nalaskowski MM, et al.
The Biochemical Journal, 366(2), 549-556 (2002)
Association between genetic traits for immune-mediated diseases and Alzheimer disease
Yokoyama JS, et al.
JAMA Neurology, 73(6), 691-697 (2016)
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique