Accéder au contenu
Merck
Toutes les photos(4)

Documents

AV32697

Sigma-Aldrich

Anti-MEOX1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Mesenchyme homeobox 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

28 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MEOX1(4222)

Description générale

MEOX1 is a homeobox transcription factor that regulates somite development. It is known to maintain sclerotome polarity and is also involved in axial skeleton formation. MEOX1 mutations have been linked to Klippel-Feil syndrome (KFS).
Rabbit Anti-MEOX1 bovine, canine, and human MEOX1.

Immunogène

Synthetic peptide directed towards the N terminal region of human MEOX1

Application

Rabbit Anti-MEOX1 can be used for western blot applications at a concentration of 0.2-2.0μg/ml. It can also be used for IHC at 4-8μg/ml using paraffin-embedded tissues.

Actions biochimiques/physiologiques

MEOX1 belongs to a family of nonclustered, diverged homeobox genes. It may play a role in regulating growth and differentiation.

Séquence

Synthetic peptide located within the following region: YPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Mutation in MEOX1 gene causes a recessive Klippel-Feil syndrome subtype.
Bayrakli F, et al. et al.
BMC Genetics (2013)
Susan Skuntz et al.
Developmental biology, 332(2), 383-395 (2009-06-13)
Meox1 and Meox2 are two related homeodomain transcription factor genes that together are essential for the development of all somite compartments. Here we show that mice homozygous for Meox1 mutations alone have abnormalities that are restricted to the sclerotome and

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique