Accéder au contenu
Merck
Toutes les photos(2)

Documents

AV13060

Sigma-Aldrich

Anti-GRIA2 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Glutamate receptor, ionotropic, AMPA 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

99 kDa

Espèces réactives

rabbit, mouse, horse, bovine, rat, guinea pig, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... GRIA2(2891)

Immunogène

Synthetic peptide directed towards the N terminal region of human GRIA2

Application

Anti-GRIA2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Actions biochimiques/physiologiques

GRIA2 or glutamate receptor 2 (GluR2) inhibits the influx of calcium through AMPA-receptor complexes. Mutations in GRIA2 gene have been associated with major psychiatric disorders such as schizophrenia and bipolar disorder.

Séquence

Synthetic peptide located within the following region: PRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSR

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Junyu Xu et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(46), 15415-15424 (2014-11-14)
In the CNS, synapse formation and maturation play crucial roles in the construction and consolidation of neuronal circuits. Neurexin and neuroligin localize on the opposite sides of synaptic membrane and interact with each other to promote the assembly and specialization
Andy N Mead et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 23(29), 9500-9507 (2003-10-24)
Presence of the glutamate receptor 2 (GluR2) subunit prevents calcium influx through AMPA-receptor complexes; deletion of this subunit results in enhanced hippocampal long-term potentiation. We investigated whether mice lacking the GluR2 subunit [gria2 knock-out (KO) mice] displayed impairments in learning
Alberto Chiesa et al.
European archives of psychiatry and clinical neuroscience, 262(4), 305-311 (2011-11-08)
The present study is aimed to exploring whether some single nucleotide polymorphisms (SNPs) within GRIA1, GRIA2 and GRIA4 could be associated with major depressive disorder (MDD) and whether they could predict clinical outcomes in Korean in-patients, respectively, treated with antidepressants.
Sarah L Ferri et al.
Hormones and behavior, 66(2), 409-420 (2014-07-06)
Ovarian hormones act in multiple brain regions to modulate specific behaviors and emotional states. For example, ovarian hormones promote female sexual receptivity in the hypothalamic ventromedial nucleus (VMH) and modulate anxiety in the amygdala. Hormone-induced changes within the VMH include

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique