Synthetic peptide directed towards the middle region of human TSPAN32
Application
Anti-TSPAN32 (AB2) antibody produced in rabbit has been used for western blotting at a concentration of 5μg/ml. It has also been used for immunohistochemistry at a concentration of 4-8μg/ml.
Biochem/physiol Actions
TSPAN32 encodes for tetraspanin 32 protein, that belongs to tetraspanin superfamily and is expressed mainly in hematopoietic tissues comprising peripheral blood leukocytes, thymus and spleen. It plays a crucial role in hematopoietic cell function. Additionally, it also facilitates the gulating T cell proliferation responses in vitro. TSSC6 along with CD37 regulates the antipathogen cellular immunity.
Sequence
Synthetic peptide located within the following region: YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Journal of immunology (Baltimore, Md. : 1950), 185(6), 3158-3166 (2010-08-17)
The cooperative nature of tetraspanin-tetraspanin interactions in membrane organization suggests functional overlap is likely to be important in tetraspanin biology. Previous functional studies of the tetraspanins CD37 and Tssc6 in the immune system found that both CD37 and Tssc6 regulate
Biochimica et biophysica acta, 1522(1), 31-41 (2001-11-24)
Previous analyses of the murine and human TSSC6 (also known as Phemx) proteins were not carried out using the full length sequence. Using 5'-RACE and cDNA library screening, we identified an additional 5' sequence for both the murine Tssc6 cDNA
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.