SAB1412163

ANTI-SUPT16H antibody produced in mouse

clone 4D6, purified immunoglobulin, buffered aqueous solution

• Sinónimos: CDC68, FACT, FACTP140, FLJ10857, SUPT16H
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 4D6, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen 37.62 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_007192
• Nº de acceso UniProt: Q9Y5B9
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SUPT16H(11198)

Descripción

Descripción general

Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit; this gene encodes the 140 kDa subunit. (provided by RefSeq)

Inmunógeno

SUPT16H (NP_009123, 608 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable