Saltar al contenido
Merck
Todas las fotos(1)

Documentos

HPA025062

Sigma-Aldrich

Anti-SLCO5A1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-OATP-RP4, Anti-OATPRP4, Anti-Organic anion transporter polypeptide-related protein 4, Anti-Solute carrier family 21 member 15, Anti-Solute carrier organic anion transporter family member 5A1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
HPA025062
NACRES:
NA.43

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunohistochemistry: 1:20- 1:50

secuencia del inmunógeno

SVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRDLPRAAVRILSNM

Nº de acceso UniProt

Q9H2Y9

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SLCO5A1(81796)

Descripción general

The gene SLCO5A1 (solute carrier organic anion transporter family member 5A1) is mapped to human chromosome 8q13.3. The mRNA is expressed in the brain, heart, skeletal muscle and ovary. In addition, it is also expressed in bone tumors, prostate cancer, breast cancer, drug-resistant small cell lung cancer and liver cancer. The SLCO5A1 protein belongs to the OATP5 (organic anion-transporting polypeptide 5) family of proteins. The protein has 12 transmembrane domains and shows different localization depending on the tissue.

Inmunógeno

Solute carrier organic anion transporter family member 5A1 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-SLCO5A1 antibody produced in rabbit has been used in Western blotting, immunofluorescence and flow cytometry.

Acciones bioquímicas o fisiológicas

SLCO5A1 (solute carrier organic anion transporter family member 5A1) might be involved in cellular responses associated with the reorganization of the cell morphology, for instance differentiation and migration.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST76253

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

U Olszewski-Hamilton et al.
Biomarkers in cancer, 3, 31-40 (2011-01-01)
The role of organic anion transporting polypeptide 5A1 (OATP5A1) a member of a family of drug transporters that mediate cellular uptake of drugs has not been characterized so far. Gene expression levels of OATP5A1 in small cell lung cancer (SCLC)
Izabel Patik et al.
Biochemical pharmacology, 98(4), 649-658 (2015-09-30)
Organic Anion Transporting Polypeptides (OATPs), encoded by genes of the Solute Carrier Organic Anion (SLCO) family, are transmembrane proteins involved in the uptake of various compounds of endogenous or exogenous origin. In addition to their physiological roles, OATPs influence the
Bertrand Isidor et al.
American journal of human genetics, 87(1), 95-100 (2010-07-07)
Mesomelia-synostoses syndrome (MSS) or mesomelic dysplasia with acral synostoses Verloes-David-Pfeiffer type is a rare autosomal-dominant disorder characterized by mesomelic limb shortening, acral synostoses, and multiple congenital malformations. So far, five patients in four unrelated families have been reported worldwide with
Katrin Sebastian et al.
PloS one, 8(12), e83257-e83257 (2014-01-01)
Organic anion transporting polypeptides (OATP/SLCO) have been identified to mediate the uptake of a broad range of mainly amphipathic molecules. Human OATP5A1 was found to be expressed in the epithelium of many cancerous and non-cancerous tissues throughout the body but

Artículos

Protein-based Drug Transport

Protein-based drug transporters are expressed in Sf9 cells. Understanding the specific mechanisms of tumor cell transporters is an essential aspect of chemotherapeutic drug design.

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico