HPA006314

Anti-PARN antibody produced in rabbit

Ab1, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Deadenylating nuclease antibody produced in rabbit, Anti-Deadenylation nuclease antibody produced in rabbit, Anti-Poly(A)-specific ribonuclease PARN antibody produced in rabbit, Anti-Polyadenylate-specific ribonuclease antibody produced in rabbit
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA006314
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human, mouse, rat
• validación mejorada: independent; Learn more about Antibody Enhanced Validation
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• secuencia del inmunógeno: DGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGA
• Nº de acceso UniProt: O95453
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PARN(5073)

Descripción

Descripción general

Poly(A)-specific ribonuclease (PARN) is a 3′- exoribonuclease found in mammals. It is a member of the DEDD (death effector domain-containing protein) family of nucleases, and is a divalent metal-ion dependent enzyme. It is divided into three structural domains, with the nuclease domain harboring the active site. This protein also contains RNA-recognition motif (RRM) and the R3H domain, which function as RNA-binding domains. This gene is localized to human chromosome 16p13.

Inmunógeno

Poly(A)-specific ribonuclease PARN recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

Poly(A)-specific ribonuclease (PARN) is one of the rare mammalian exonucleases that has a high specificity for poly(A) degradation. It interacts with both the poly(A) tail and with the 5′ end-located cap-structure. It is a highly processive enzyme as its interaction with 5′-end cap enhances its rate of degradation. This protein is up-regulated in gastric cancer, and its inactivation results in cell cycle arrest, thus, inhibiting the proliferation of gastric cancer cells.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST70834

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)