Saltar al contenido
Merck
Todas las fotos(1)

Documentos

AV51358

Sigma-Aldrich

Anti-JPH2 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-FLJ40969, Anti-JP-2, Anti-JP2, Anti-Junctophilin 2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

74 kDa

reactividad de especies

dog, human, horse, guinea pig, bovine, rat, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_065166

Nº de acceso UniProt

Q9BR39

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... JPH2(57158)

Inmunógeno

Synthetic peptide directed towards the middle region of human JPH2

Aplicación

Anti-JPH2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.

Acciones bioquímicas o fisiológicas

Junctophilin 2 (JPH2; CMH17) is a member of the junctophilin family. The members of this family form the junctional complexes present between the plasma membrane and the endoplasmic/sarcoplasmic reticululm. JPH2 couples the sarcolemmal and the intracellular calcium channels in the skeletal and cardiac muscle. The expression of JPH2 is essential for the formation of postnatal T-tubule in mammals. Dysregulation of junctophilins result in a variety of cardiac disorders.

Secuencia

Synthetic peptide located within the following region: ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

David L Beavers et al.
Cardiovascular research, 103(2), 198-205 (2014-06-18)
Cardiomyocytes rely on a highly specialized subcellular architecture to maintain normal cardiac function. In a little over a decade, junctophilin-2 (JPH2) has become recognized as a cardiac structural protein critical in forming junctional membrane complexes (JMCs), which are subcellular domains
Andrew P Landstrom et al.
Trends in molecular medicine, 20(6), 353-362 (2014-03-19)
Excitable tissues rely on junctional membrane complexes to couple cell surface signals to intracellular channels. The junctophilins have emerged as a family of proteins critical in coordinating the maturation and maintenance of this cellular ultrastructure. Within skeletal and cardiac muscle
Alejandro Garbino et al.
Physiological genomics, 37(3), 175-186 (2009-03-26)
Junctophilins (JPHs) are members of a junctional membrane complex protein family important for the physical approximation of plasmalemmal and sarcoplasmic/endoplasmic reticulum membranes. As such, JPHs facilitate signal transduction in excitable cells between plasmalemmal voltage-gated calcium channels and intracellular calcium release
Yoshihisa Matsushita et al.
Journal of human genetics, 52(6), 543-548 (2007-05-04)
Junctophilin subtypes, designated as JPH1 approximately 4, are protein components of junctional complexes and play essential roles in cellular Ca2+ signaling in excitable cells. Knockout mice lacking the cardiac-type Jph2 die of embryonic cardiac arrest, and the mutant cardiac myocytes

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico