AV51203

Anti-OLFM4 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-GC1, Anti-GW112, Anti-KIAA4294, Anti-OlfD, Anti-Olfactomedin 4, Anti-bA209J19.1
• Código UNSPSC: 12352203
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 55 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_006409
• Nº de acceso UniProt: Q6UX06
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... OLFM4(10562)

Descripción

Descripción general

Olfactomedin-4 (OLFM4), an olfactomedin domain-containing protein, belongs to the olfactomedin-related protein family. OLFM4 is found in the cytoplasm, mitochondria, and membrane including, other subcellular compartments. It is a disulfide-bonded multimer with a signal peptide and six N-linked glycosylation motifs. OLFM4 has a coil-coil domain at the N-terminus and an olfactomedin domain at the C-terminus. Endogenous expression of the OLFM4 protein is seen in mature neutrophils and gastric and intestinal epithelial cells. It is expressed ubiquitously in intestinal crypts and is secreted extracellularly. OLFM4 gene is located on human chromosome 13q14.3.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human OLFM4

Aplicación

Anti-OLFM4 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Acciones bioquímicas o fisiológicas

Olfactomedin 4 (OLFM4) has a role in tumor growth. OLFM4 has been identified as an anti-apoptotic factor and an extracellular matrix (ECM) glycoprotein.

Olfactomedin-4 (OLFM4) can mediate cell adhesion by binding to cadherins and lectins. It may play a role in the defense of the gastrointestinal mucosal surface. Overexpression of the OLFM4 mRNA is observed in gastric and colon cancer patients. In the human intestine, OLFM4 is considered a powerful marker for stem cells.

Secuencia

Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable