Saltar al contenido
Merck
Todas las fotos(2)

Documentos

AV44297

Sigma-Aldrich

Anti-C1QB antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Complement component 1, q subcomponent, B chain

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

27 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

NP_000482

Nº de acceso UniProt

P02746

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... C1QB(713)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human C1QB

Aplicación

Anti-C1QB antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Acciones bioquímicas o fisiológicas

C1QB is the B-chain polypeptide of the C1Q component of the human serum complement system. C1Q initiates complement activation and additionally modulates cytokine production, dendritic cell maturation and T-cell and B-cell responses. Mutation in gene encoding for C1QB is associated with systemic lupus erythematosus while polymorphisms in the gene have been observed in schizophrenia.

Secuencia

Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Yousuke Higuchi et al.
Pediatric rheumatology online journal, 11(1), 41-41 (2013-10-29)
C1q deficiency is a rare disease that is associated with a high probability of developing systemic lupus erythematosus. We report a 4-year-old Japanese girl who presented with fever, facial erythema, joint pain, and oral ulceration. Complement deficiencies were suspected because
Yi Cai et al.
PloS one, 9(3), e92340-e92340 (2014-03-22)
Complement functions as an important host defense system and complement C5 and C7 have been implicated in immunopathology of tuberculosis. However, little is known about the role of other complement components in tuberculosis. Complement gene expression in peripheral blood mononuclear
Roksana Zakharyan et al.
BMC medical genetics, 12, 126-126 (2011-09-29)
Schizophrenia is a complex, multifactorial psychiatric disorder. Our previous findings indicated that altered functional activity of the complement system, a major mediator of the immune response, is implicated in the pathogenesis of schizophrenia. In order to explore whether these alterations

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico