Saltar al contenido
Merck
Todas las fotos(3)

Documentos

AV13038

Sigma-Aldrich

Anti-GRIA2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Glutamate receptor, ionotropic, AMPA 2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

99 kDa

reactividad de especies

bovine, rat, guinea pig, horse, rabbit, mouse, human

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

NP_001077088

Nº de acceso UniProt

P42262

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... GRIA2(2891)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human GRIA2

Aplicación

Anti-GRIA2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.

Acciones bioquímicas o fisiológicas

GRIA2 or glutamate receptor 2 (GluR2) inhibits the influx of calcium through AMPA-receptor complexes. Mutations in GRIA2 gene have been associated with major psychiatric disorders such as schizophrenia and bipolar disorder.

Secuencia

Synthetic peptide located within the following region: STSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTIT

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Junyu Xu et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(46), 15415-15424 (2014-11-14)
In the CNS, synapse formation and maturation play crucial roles in the construction and consolidation of neuronal circuits. Neurexin and neuroligin localize on the opposite sides of synaptic membrane and interact with each other to promote the assembly and specialization
Andy N Mead et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 23(29), 9500-9507 (2003-10-24)
Presence of the glutamate receptor 2 (GluR2) subunit prevents calcium influx through AMPA-receptor complexes; deletion of this subunit results in enhanced hippocampal long-term potentiation. We investigated whether mice lacking the GluR2 subunit [gria2 knock-out (KO) mice] displayed impairments in learning
Alberto Chiesa et al.
European archives of psychiatry and clinical neuroscience, 262(4), 305-311 (2011-11-08)
The present study is aimed to exploring whether some single nucleotide polymorphisms (SNPs) within GRIA1, GRIA2 and GRIA4 could be associated with major depressive disorder (MDD) and whether they could predict clinical outcomes in Korean in-patients, respectively, treated with antidepressants.
Sarah L Ferri et al.
Hormones and behavior, 66(2), 409-420 (2014-07-06)
Ovarian hormones act in multiple brain regions to modulate specific behaviors and emotional states. For example, ovarian hormones promote female sexual receptivity in the hypothalamic ventromedial nucleus (VMH) and modulate anxiety in the amygdala. Hormone-induced changes within the VMH include

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico