Skip to Content
Merck
All Photos(1)

Documents

AV46881

Sigma-Aldrich

Anti-LETM1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Leucine zipper-EF-hand containing transmembrane protein 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

60 kDa

species reactivity

dog, mouse, horse, guinea pig, bovine, human, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... LETM1(3954)

Immunogen

Synthetic peptide directed towards the middle region of human LETM1

Application

Anti-LETM1 antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL.

Biochem/physiol Actions

LETM1 (leucine zipper-EF-hand containing transmembrane protein 1) gene encodes a single-pass membrane protein localized in the inner mitochondrial membrane. It plays a pivotal role in maintaining the mitochondrial tubular shape as well as cristae organization. It also facilitates the normal mitochondrial morphology and cellular viability. Mutation in LETM1 gene leads to Wolf-Hirschhorn syndrome.

Sequence

Synthetic peptide located within the following region: MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Kai Stefan Dimmer et al.
Human molecular genetics, 17(2), 201-214 (2007-10-11)
Wolf-Hirschhorn syndrome (WHS) is a complex congenital syndrome caused by a monoallelic deletion of the short arm of chromosome 4. Seizures in WHS have been associated with deletion of LETM1 gene. LETM1 encodes for the human homologue of yeast Mdm38p
Xiaogang Zhang et al.
Cerebral cortex (New York, N.Y. : 1991), 24(10), 2533-2540 (2013-05-07)
Leucine zipper-EF-hand containing transmembrane protein 1 (Letm1) is a mitochondrial protein that is associated with seizure attacks in Wolf-Hirschhorn syndrome. This study aimed to investigate the expression pattern of Letm1 in patients with temporal lobe epilepsy (TLE) and pilocarpine-induced rat
Shoko Tamai et al.
Journal of cell science, 121(Pt 15), 2588-2600 (2008-07-17)
LETM1 is located in the chromosomal region that is deleted in patients suffering Wolf-Hirschhorn syndrome; it encodes a homolog of the yeast protein Mdm38 that is involved in mitochondrial morphology. Here, we describe the LETM1-mediated regulation of the mitochondrial volume

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service