KCNAB1 codes for a member of potassium voltage-gated channel (shaker-related) protein subfamily. KCNAB1 forms a β subunit and associates with α subunits to form heteromeric complexes that modulate pore formation. Genetic variations in KCNAB1 have been linked to lateral temporal epilepsy. Rabbit Anti-KCNAB1 antibody recognizes rabbit, canine, human, mouse, rat, chicken, pig, bovine, and zebrafish KCNAB1.
Immunogen
Synthetic peptide directed towards the C terminal region of human KCNAB1
Application
Rabbit Anti-KCNAB1 antibody is suitable for western blot applications at a concentration of 1 μg/ml.
Biochem/physiol Actions
Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The KCNAB1 gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily.
Sequence
Synthetic peptide located within the following region: VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The KCNAB1 gene is a candidate susceptibility factor for lateral temporal epilepsy (LTE) because of its functional interaction with LGI1, the gene responsible for the autosomal dominant form of LTE. We investigated association between polymorphic variants across the KCNAB1 gene
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
