WH0000308M1

Monoclonal Anti-ANXA5 antibody produced in mouse

clone 1F4-1A5, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : ANX5, ENX2, PP4, annexin A5
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 1F4-1A5, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès GenBank: BC001429
• Numéro d'accès UniProt: P08758
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ANXA5(308)

Description

Description générale

The annexin A5 (ANXA5) gene is mapped to human chromosome 4q26-q28 and spans a length of 28kb containing 13 exons and 12 introns. ANXA5 is a member of the annexin family of calcium and membrane-binding proteins that have anti-coagulatory and anti-inflammatory properties. The encoded protein is 320 amino acid long and is folded into four domains, each having five α-helices, forming a superhelical globular structure.

The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. (provided by RefSeq)

Immunogène

ANXA5 (AAH01429, 1 a.a. ~ 320 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Application

The annexin A5 (ANXA5) gene is mapped to human chromosome 4q26-q28 and spans a length of 28kb containing 13 exons and 12 introns. ANXA5 is a member of the annexin family of calcium and membrane-binding proteins that have anti-coagulatory and anti-inflammatory properties. The encoded protein is 320 amino acid long and is folded into four domains, each having five α-helices, forming a superhelical globular structure.

Actions biochimiques/physiologiques

Annexins are a family of water-soluble proteins that bind to membranes and phospholipids in a calcium-dependent manner. They participate in several cellular functions, such as membrane fusion and cytoskeletal interaction. ANXA5 is a potent anticoagulant and serves as a voltage-gated calcium channel when bound to membrane in vitro. It is found to inhibit phospholipase A2 and protein kinase C.

Caractéristiques et avantages

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)