HPA018403
Anti-RBM8A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-BOV-1, Anti-Binder of OVCA1- 1, Anti-RNA-binding motif protein 8A, Anti-RNA-binding protein 8A, Anti-RNA-binding protein Y14, Anti-Ribonucleoprotein RBM8A
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Gamme de produits
Prestige Antibodies® Powered by Atlas Antibodies
Forme
buffered aqueous glycerol solution
Espèces réactives
human
Validation améliorée
RNAi knockdown
Learn more about Antibody Enhanced Validation
Technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
Séquence immunogène
MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... RBM8A(9939)
Description générale
The gene RBM8A (RNA-binding motif protein 8A) is mapped to human chromosome 1q21.1. It belongs to a conserved RNA-binding motif protein family. RBM8A is ubiquitously expressed in human tissues. The protein shuttles between the nucleus and the cytoplasm. The protein is popularly known as Y14.
Immunogène
RNA-binding protein 8A recombinant protein epitope signature tag (PrEST)
Application
Anti-RBM8A antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Actions biochimiques/physiologiques
RNA-binding motif protein 8A (RBM8A) is an RNA binding protein. It is part of the exon-exon junction complex (EJC), which is present on the exon-exon junctions of spliced mRNAs. RBM8A interacts with UPF3B (up-frameshift suppressor-3 homolog B) and together they are essential for nonsense-mediated mRNA decay. RBM8A also controls the alternative splicing of apoptotic regulators. Absence of RBM8A increase production of proapoptotic Bcl-x(S) splice variant. Apart from being an exon junction complex protein, RBM8A associates with receptor-interacting protein-1 (RIP1) and TNFR (tumor necrosis factor receptor)-associated death domain, and positively regulates TNF-α-induced IL (Interleukin)-6 expression in HeLa cells. RBM8A interacts directly with decapping factor DCP2 and the 5′ cap structure of mRNAs, and inhibits the mRNA-decapping activity of DCP2. RBM8A interacts with STAT3 (signal transducer and activator of transcription-3) and regulates its activation by influencing the IL-6-induced tyrosine-phosphorylation of STAT3.
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST73962
Forme physique
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Équipement de protection individuelle
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Laetitia Michelle et al.
Molecular and cellular biology, 32(5), 954-967 (2011-12-29)
Several apoptotic regulators, including Bcl-x, are alternatively spliced to produce isoforms with opposite functions. We have used an RNA interference strategy to map the regulatory landscape controlling the expression of the Bcl-x splice variants in human cells. Depleting proteins known
Sumihito Togi et al.
Journal of immunology (Baltimore, Md. : 1950), 191(3), 1436-1444 (2013-07-03)
Although Y14 is known to be a component of the exon junction complex, we previously reported that Y14 regulates IL-6-induced STAT3 activation. In this study, we showed that endogenous Y14 positively regulated TNF-α-induced IL-6 expression in HeLa cells. Small interfering
Josée Dostie et al.
Current biology : CB, 12(13), 1060-1067 (2002-07-18)
Y14 is an RNA binding protein which is part of a multiprotein complex, the exon-exon junction complex (EJC), that assembles on the exon-exon junctions of mRNAs produced by splicing. The position-specific binding of Y14 persists on mRNAs after their export
Tzu-Wei Chuang et al.
Molecular biology of the cell, 24(1), 1-13 (2012-11-02)
The exon-junction complex (EJC) deposited on a newly spliced mRNA plays an important role in subsequent mRNA metabolic events. Here we show that an EJC core heterodimer, Y14/Magoh, specifically associates with mRNA-degradation factors, including the mRNA-decapping complex and exoribonucleases, whereas
X F Zhao et al.
Genomics, 63(1), 145-148 (2000-02-09)
MAGOH is the human homologue of Drosophila mago nashi, a protein that is required for normal germ plasm development in the Drosophila embryo. Using human MAGOH as a bait protein in a yeast two-hybrid screen, we recovered four independent cDNA
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique