Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

AV100880

Sigma-Aldrich

Anti-EGR2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-CMT1D, Anti-CMT4E, Anti-DKFZp686J1957, Anti-Early growth response 2 (Krox-20 homolog, Drosophila), Anti-FLJ14547, Anti-KROX20

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

50 kDa

Espèces réactives

mouse, bovine, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_000390

Numéro d'accès UniProt

P11161

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... EGR2(1959)

Description générale

Early growth response (EGR) proteins are transcriptional regulators (EGR1-4) of gene expression involved in the growth and differentiation of many cells. Early growth response 2 (EGR2, Krox20, CMT1D, CMT4E), a C2H2-type zinc-finger protein, regulates a wide spectrum of cellular responses including differentiation (osteoclast), tissue (brain) patterning, and apoptosis.

Spécificité

Rabbit polyclonal anti-EGR2 antibody reacts with zebrafish, canine, human, mouse, rat, and pig early growth response 2 factors.

Immunogène

Synthetic peptide directed towards the C terminal region of human EGR2

Application

Rabbit polyclonal anti-EGR2 antibody is used to tag early growth response 2 factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of early growth response 2 factor in cell processes such as differentiation (osteoclast), tissue (brain) patterning, and apoptosis. Anti-EGR2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Séquence

Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

V P Sukhatme
Journal of the American Society of Nephrology : JASN, 1(6), 859-866 (1990-12-01)
How eucaryotic cells respond to growth signals is a topic of considerable interest. Though much attention has focused on second messenger pathways, in recent years, progress has been made on elucidating the transcriptional events that lie more distally in the
Yankel Gabet et al.
Blood, 116(19), 3964-3971 (2010-08-19)
Krox20/EGR2, one of the 4 early growth response genes, is a highly conserved transcription factor implicated in hindbrain development, peripheral nerve myelination, tumor suppression, and monocyte/macrophage cell fate determination. Here, we established a novel role for Krox20 in postnatal skeletal
Charlotte Labalette et al.
Development (Cambridge, England), 138(2), 317-326 (2010-12-24)
Vertebrate hindbrain segmentation is an evolutionarily conserved process that involves a complex interplay of transcription factors and signalling pathways. Fibroblast growth factor (FGF) signalling plays a major role, notably by controlling the expression of the transcription factor Krox20 (Egr2), which
Hozo Matsuoka et al.
International journal of molecular sciences, 19(2) (2018-02-09)
Neurotropin® (NTP), a non-protein extract of inflamed rabbit skin inoculated with vaccinia virus, is clinically used for the treatment of neuropathic pain in Japan and China, although its effect on peripheral nerve regeneration remains to be elucidated. The purpose of

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique