AMAB90565

Monoclonal Anti-PCM1 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL0206, purified immunoglobulin, buffered aqueous glycerol solution

• Synonyme(s) : PTC4
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: CL0206, monoclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 1 μg/mL; immunohistochemistry: 1:200- 1:500
• Isotype: IgG1
• Numéro d'accès Ensembl | humain: ENSG00000078674
• Numéro d'accès UniProt: Q15154
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PCM1(5108)

Description

Description générale

Pericentriolar material 1 (PCM1) gene codes for a 228 kDa protein. It has various coiled-coil domains in its amino-terminal. It is located in the cytoplasmic granules and is termed as centriolar satellites. PCM1 is located on human chromosome 8p22.

Immunogène

pericentriolar material 1 recombinant protein epitope signature tag (PrEST)

Sequence
TIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFE

Epitope
Binds to an epitope located within the peptide sequence RQRALYALQD as determined by overlapping synthetic peptides.

Actions biochimiques/physiologiques

Pericentriolar material 1 (PCM1) plays a major role in the development of cell cycle. It maintains the centrosome integrity and controls the microtubule cytoskeleton. PCM1 plays a vital role in the progression of the nervous system and neuronal activity. This protein participates in the enrolment of GABARAP (γ-aminobutyric acid receptor-associated protein) to the pericentriolar material.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST76188

Forme physique

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1