Skip to Content
Merck
All Photos(3)

Key Documents

WH0051232M1

Sigma-Aldrich

Monoclonal Anti-CRIM1 antibody produced in mouse

clone 6E4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-S52, Anti-cysteine-rich motor neuron 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

6E4, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CRIM1(51232)

General description

The gene encoding cysteine-rich motor neuron 1 (CRIM1) is localized on human chromosome 2p21. It is a putative transmembrane protein which possesses an insulin-like growth factor (IGF)-binding protein motif and multiple cysteine-rich repeats. CRIM1 is an antagonist of bone morphogenetic proteins. The CRIM1 gene encodes a type I transmembrane protein that is mainly expressed in angiogenic endothelial cells.

Immunogen

CRIM1 (NP_057525, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI

Application

Monoclonal Anti-CRIM1 antibody produced in mouse has been used in Western blotting.

Biochem/physiol Actions

Cysteine-rich motor neuron 1 (CRIM1) may interact with growth factors implicated in motor neuron differentiation and survival. It may have a role in the development of the central nervous system (CNS). CRIM1 influences the adhesion and migration of cancer cells. It modulates the maturation of bone morphogenetic preprotein.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

CRIM1, a newfound cancer-related player, regulates the adhesion and migration of lung cancer cells.
Zeng H
Growth Factors (2015)
CRIM1, a novel gene encoding a cysteine-rich repeat protein, is developmentally regulated and implicated in vertebrate CNS development and organogenesis.
Kolle G
Mechanisms of Development (2000)
Crim1 maintains retinal vascular stability during development by regulating endothelial cell Vegfa autocrine signaling
Jieqing Fan
Development (2014)
CRIM1, the antagonist of BMPs, is a potential risk factor of cancer.
Zeng H and Tang L
Current Cancer Drug Targets (2014)
Jieqing Fan et al.
Development (Cambridge, England), 141(2), 448-459 (2013-12-20)
Angiogenesis defines the process in which new vessels grow from existing vessels. Using the mouse retina as a model system, we show that cysteine-rich motor neuron 1 (Crim1), a type I transmembrane protein, is highly expressed in angiogenic endothelial cells.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service