Skip to Content
Merck
All Photos(1)

Key Documents

AV09047

Sigma-Aldrich

Anti-BCL2A1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-BCL2-related protein A1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
3.490,00 kr.

3.490,00 kr.


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
3.490,00 kr.

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

3.490,00 kr.


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

20 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BCL2A1(597)

General description

BCL2 proteins are important regulators of cell death and survival. They are recognized as cellular oncogenes that are often deregulated in cancers.

Immunogen

Synthetic peptide directed towards the C terminal region of human BCL2A1

Application

Anti- BCL2A1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Biochem/physiol Actions

The expression of BCL2A1 protein is regulated by NF-κB transcription factor. It has prosurvival and metastatic effects and facilitates survival of leukocytes subsets and inflammation. It is upregulated in melanomas and chronic inflammatory diseases.

Sequence

Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

M Vogler
Cell death and differentiation, 19(1), 67-74 (2011-11-15)
B-cell lymphoma 2 (BCL2) proteins are important cell death regulators, whose main function is to control the release of cytochrome c from mitochondria in the intrinsic apoptotic pathway. They comprise both pro- and anti-apoptotic proteins, which interact in various ways
Rizwan Haq et al.
Proceedings of the National Academy of Sciences of the United States of America, 110(11), 4321-4326 (2013-03-01)
Although targeting oncogenic mutations in the BRAF serine/threonine kinase with small molecule inhibitors can lead to significant clinical responses in melanoma, it fails to eradicate tumors in nearly all patients. Successful therapy will be aided by identification of intrinsic mechanisms
William Cruz-Muñoz et al.
Cancer research, 72(19), 4909-4919 (2012-08-07)
Metastatic spread of melanoma to the central nervous system (CNS) is a common and devastating manifestation of disease progression, which, despite its clinical importance, remains poorly understood with respect to underlying molecular mechanisms. Using a recently developed preclinical model of

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service