Skip to Content
Merck
All Photos(2)

Documents

AV44366

Sigma-Aldrich

Anti-PPIB (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-CYP-S1, Anti-CYPB, Anti-MGC14109, Anti-MGC2224, Anti-Peptidylprolyl isomerase B (cyclophilin B), Anti-SCYLP

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

24 kDa

species reactivity

human, horse, rabbit, mouse, dog, bovine, rat, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... PPIB(5479)

Immunogen

Synthetic peptide directed towards the C terminal region of human PPIB

Application

Anti-PPIB (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Biochem/physiol Actions

Peptidylprolyl isomerase B (PPIB; cyclophilin B) is a protein released with secretory pathway in the biological fluids by the rough endoplasmic reticulum. It is involved in the regulation of cyclosporine A-mediated immunosuppression. Mutations in the PPIB gene cause a delay in procollagen chain association in osteoblasts that is one of the features of osteogenesis imperfecta phenotypes.

Sequence

Synthetic peptide located within the following region: VVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Fleur S van Dijk et al.
American journal of human genetics, 85(4), 521-527 (2009-09-29)
Deficiency of cartilage-associated protein (CRTAP) or prolyl 3-hydroxylase 1(P3H1) has been reported in autosomal-recessive lethal or severe osteogenesis imperfecta (OI). CRTAP, P3H1, and cyclophilin B (CyPB) form an intracellular collagen-modifying complex that 3-hydroxylates proline at position 986 (P986) in the
Shawna M Pyott et al.
Human molecular genetics, 20(8), 1595-1609 (2011-02-02)
Recessive mutations in the cartilage-associated protein (CRTAP), leucine proline-enriched proteoglycan 1 (LEPRE1) and peptidyl prolyl cis-trans isomerase B (PPIB) genes result in phenotypes that range from lethal in the perinatal period to severe deforming osteogenesis imperfecta (OI). These genes encode
Aileen M Barnes et al.
The New England journal of medicine, 362(6), 521-528 (2010-01-22)
Osteogenesis imperfecta is a heritable disorder that causes bone fragility. Mutations in type I collagen result in autosomal dominant osteogenesis imperfecta, whereas mutations in either of two components of the collagen prolyl 3-hydroxylation complex (cartilage-associated protein [CRTAP] and prolyl 3-hydroxylase
Jie Qing et al.
PLoS pathogens, 10(10), e1004422-e1004422 (2014-10-03)
Viruses utilize host factors for their efficient proliferation. By evaluating the inhibitory effects of compounds in our library, we identified inhibitors of cyclophilin A (CypA), a known immunosuppressor with peptidyl-prolyl cis-trans isomerase activity, can significantly attenuate EV71 proliferation. We demonstrated

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service