SAB1403498

Monoclonal Anti-ANKRD37 antibody produced in mouse

clone 6E8, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Lrp2bp, MGC111507
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 6E8, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~43.9 kDa
• Speziesreaktivität: human
• Methode(n): capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_181726
• UniProt-Hinterlegungsnummer: Q7Z713
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ANKRD37(353322)

Beschreibung

Allgemeine Beschreibung

Ankyrin repeat domain 37 (ANKRD37) is a protein containing ankyrin repeats (ARs) and a nuclear localization signal (NLS). The protein is expressed in human testis, small intestine, colon, blood leukocytes and human pancreatic adenocarcinoma cells. The gene is located on human chromosome 4q35.1.

Immunogen

ANKRD37 (NP_859077.1, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC

Biochem./physiol. Wirkung

Ankyrin repeat domain 37 (ANKRD37) is important in protein-protein interactions and signalling pathways. It acts as a target gene for hypoxia-inducible factor 1 (HIF-1).

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable