SAB1404393

Monoclonal Anti-SOX4 antibody produced in mouse

clone 1E5, purified immunoglobulin, buffered aqueous solution

• Synonym(s): EVI16
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1E5, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~36.23 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable
• isotype: IgG1κ
• NCBI accession no.: NM_003107
• UniProt accession no.: Q06945
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SOX4(6659)

Description

General description

This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein. (provided by RefSeq)

Immunogen

SOX4 (NP_003098, 45 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable