AV100797

Anti-SOX9 Antibody

rabbit polyclonal

• Synonym(s): Anti-SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)
• UNSPSC Code: 12352203
• NACRES: NA.41
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 3

Properties

• Product Name: Anti-SOX9 antibody produced in rabbit, IgG fraction of antiserum
• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 56 kDa
• species reactivity: rabbit, goat, mouse, bovine, human, guinea pig, rat, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_000337
• UniProt accession no.: P48436
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SOX9(6662)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human SOX9

Application

Anti-SOX9 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

Sox9 is a transcription factor involved in a wide range of developmental processes. It is required for cartilage development, morphogenesis of face, testis differentiation and sex determination.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: PCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKG

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• wgk: WGK 3
• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable