Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

WH0055294M2

Sigma-Aldrich

Monoclonal Anti-FBXW7 antibody produced in mouse

clone 3D1, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-AGO, Anti-CDC4, Anti-DKFZp686F23254, Anti-F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila), Anti-FBW7, Anti-FBX30, Anti-FBXW6, Anti-SEL10

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3D1, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... FBXW7(55294)

Catégories apparentées

Description générale

F-box and WD40 domain protein 7 (FBXW7) is a member of F-box protein family, which acts as a substrate recognition component of the ubiquitin ligase complex SCF (Skp-Cullin-F-box). The proteins have a bipartite structure. The shared F-box motif links F-box protein to Skp1 and the core complex, whereas divergent protein-protein interaction motifs selectively bind their cognate substrates. There are three FBXW7 isoforms α, β ,γ that share 10 out of 11 exons but they differ in their subcellular localization as well as in substrate recognition activity. The gene encoding FBXW7 is localized on human chromosome 4q31.3.

Immunogène

FBXW7 (NP_361014, 599 a.a. ~ 707 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK

Application

Monoclonal Anti-FBXW7 antibody produced in mouse has been used in Western blotting and immunohistochemistry.

Actions biochimiques/physiologiques

F-box proteins are associated with various signaling pathways, such as nutrient sensing in yeast, conserved developmental pathways in plants and animals. These proteins mediate recognition of phosphorylated targets including Cyclin E, Myc, c-Jun, and Notch, leading to their ubiquitination and degradation. Similar to the inactivation mode of other known tumor suppressors, the SV40 large T antigen binds F-box and WD40 domain protein 7 (FBXW7) without detectible effects on its stability, and thus acts as an inhibitor of FBXW7 activity.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Inactivation of hCDC4 can cause chromosomal instability
Harith Rajagopalan
Nature, 428 (2004)
The F-box: a new motif for ubiquitin dependent proteolysis in cell cycle regulation and signal transduction.
K L Craig and M Tyers
Progress in Biophysics and Molecular Biology, 72 (1999)
FBXW7 Acts as an Independent Prognostic Marker and Inhibits Tumor Growth in Human Osteosarcoma
Zhanchun Li
International Journal of Molecular Sciences (2015)
MicroRNA-92a contributes to tumor growth of human hepatocellular carcinoma by targeting FBXW7
Wei Yang
Oncology Reports (2015)
Phosphorylation-dependent degradation of c-Myc is mediated by the F-box protein Fbw7
Masayoshi Yada
The Embo Journal, 23 (2004)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique