SAB5702723

Anti-Casein Kinase 1 alpha (CSNK1A1) Antibody, clone 9O4L9, Rabbit Monoclonal

• Synonyme(s) : CK1, CK1a, CKIa, HEL-S-77p, HLCDGP1, PRO2975
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 9O4L9, monoclonal
• Forme: liquid
• Poids mol.: 35 kDa
• Espèces réactives: rat, rat, human
• Concentration: 0.8 mg/mL
• Technique(s): immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: EKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
• Numéro d'accès UniProt: P48729
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CSNK1A1(1452)

Description

Description générale

Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at ′Ser-45′. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis. May play a role in keratin cytoskeleton disassembly and thereby, it may regulate epithelial cell migration.

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 238-337 of human Casein Kinase 1 alpha (CSNK1A1) (P48729).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IHC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1