SAB2101136
Anti-IGF1R antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-CD221, Anti-IGFIR, Anti-Insulin-like growth factor 1 receptor, Anti-JTK13, Anti-MGC142170
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
71 kDa
Espèces réactives
pig, horse, sheep, bovine, dog, human
Concentration
0.5 mg - 1 mg/mL
Technique(s)
immunofluorescence: suitable
immunohistochemistry: suitable
western blot: suitable
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... IGF1R(3480)
Description générale
Insulin-like growth factor 1 receptor (IGF1R), a transmembrane tyrosine kinase receptor, belongs to the insulin receptor family. It comprises juxtamembrane (JM) and transmembrane domains that harbor substrate binding sites. Structurally, IGF1R exists as a tetramer α2/β2 with the extracellular dimeric α subunits. The IGF1R gene is mapped to human chromosome 15q26.3.
Immunogène
Synthetic peptide directed towards the middle region of human IGF1R
Actions biochimiques/physiologiques
Insulin-like growth factor 1 receptor (IGF1R) is prime for IGF-1 for its mitogenic and metabolic functionality. It binds to IGF1 and IGF2 and activates phosphatidylinositol 3?kinase (PI3K)/protein kinase B (AKT) and mitogen-activated protein kinase pathways. IGF1R plays a key role in growth, differentiation, cell metabolic events, and apoptosis. It also favors proliferation in the myelodysplastic syndrome (MDS) and may serve as a potential target to treat MDS. Mutations in the IGF1R gene are implicated in the pre- and postnatal growth retardation and microcephaly. High levels of IGF1R overexpression are observed in multiple myeloma, lung, breast, bladder and pancreatic tumors.
Séquence
Synthetic peptide located within the following region: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Andrey S Kuznetsov et al.
Biochimica et biophysica acta. Biomembranes, 1862(11), 183417-183417 (2020-07-28)
Despite the biological significance of insulin signaling, the molecular mechanisms of activation of the insulin receptor (IR) and other proteins from its family remain elusive. Current hypothesis on signal transduction suggests ligand-triggered structural changes in the extracellular domain followed by
Nilda Gonzalez-Roibon et al.
Urology, 83(6), 1444-1444 (2014-04-10)
To assess the insulin-like growth factor-1 receptor (IGF1R) expression in urothelial carcinoma (UC) and its prognostic role in relation to clinicopathologic parameters. A total of 100 cases of invasive UC were evaluated using tissue microarrays. Membranous IGF1R staining was evaluated
Qi He et al.
Oncology reports, 44(3), 1094-1104 (2020-06-26)
Type 1 insulin‑like growth factor receptor (IGF‑IR) signaling is considered to serve a key role in the development of cancer. However, the effects of IGF‑IR on the malignant characteristics of myelodysplastic syndrome (MDS) clonal cells remains to be determined. In
Three novel IGF1R mutations in microcephalic patients with prenatal and postnatal growth impairment.
Matias Juanes et al.
Clinical endocrinology, 82(5), 704-711 (2014-07-22)
IGF1R gene mutations have been associated with varying degrees of intrauterine and postnatal growth retardation, and microcephaly. To identify and characterize IGF1R gene variations in a cohort of 28 Argentinean children suspected of having IGF-1 insensitivity, who were selected on
Dan Tian et al.
BMC systems biology, 8, 98-98 (2014-08-15)
The insulin-like growth factor (IGF) system impacts cell proliferation and is highly activated in ovarian cancer. While an attractive therapeutic target, the IGF system is complex with two receptors (IGF1R, IGF2R), two ligands (IGF1, IGF2), and at least six high
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique